PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca52723.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family TALE
Protein Properties Length: 667aa    MW: 74092.2 Da    PI: 6.0223
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca52723.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.91.9e-094414781954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yp+ +e+  LA+++gLt +qV +WF N R +
  Dca52723.1 441 FEHflHPYPKDSEKIMLARQTGLTRSQVANWFINARVR 478
                 664559******************************88 PP

2BELL116.41.4e-37307378172
        BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 erqelq+k  kL sll+eVd+rYkqy++q+q+++ss ++vag g+akpYt+lAlk+iSrhFrcL+dai++qi
  Dca52723.1 307 ERQELQNKLDKLHSLLDEVDRRYKQYCHQMQVLVSSLDVVAGSGAAKPYTALALKTISRHFRCLRDAITGQI 378
                 79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005745.0E-53229376IPR006563POX domain
PfamPF075262.7E-47235375IPR006563POX domain
PROSITE profilePS5007112.195419482IPR001356Homeobox domain
SMARTSM003897.0E-10422486IPR001356Homeobox domain
CDDcd000861.60E-12422483No hitNo description
SuperFamilySSF466891.58E-17423489IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-28425488IPR009057Homeodomain-like
PfamPF059202.2E-17439478IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 667 aa     Download sequence    Send to blast
MATYYPSSNA QIDVLSAPYT QDQKLASYPE SNFLHGNMMM YLNPTSSSAN FSEISSGGEN  60
YSSMSGRNEM MFIPPTGDPM SMPAISGPLN SETVENNVGN SFPGELQLTS RSHLSVMDGE  120
QNLQGLSLSL STQMSTPSFQ YQYSNPGLSS VLSPHLPLSA ENSVRQMACK VDETSPSKDM  180
RNSEYSYPYD IRGDGSNTIR FGMPNSNSPF SMNPKGVNSS NQYQYEQAAG VASALLKSKY  240
LKAAQQLLDE VVNVREAIKR HESGKEQVLN KVDEVSKESG GGSQPPSETN DSKVSGSSSV  300
QEISASERQE LQNKLDKLHS LLDEVDRRYK QYCHQMQVLV SSLDVVAGSG AAKPYTALAL  360
KTISRHFRCL RDAITGQIQA TRKSLGEPDN GMGGAIPRLR YVDQKLRQQR ALQQFGMMRH  420
AWRPQRGLPE SAVTILRAWL FEHFLHPYPK DSEKIMLARQ TGLTRSQVAN WFINARVRLW  480
KPMVEEMYKE EFGDTEINCS EDNNNTLKLA REKSWGSEDR RDEMLDSSTS MVHDAHDSKD  540
SINHNTEMNG HSSSNSGLHI NTLENNGLNH GFYNNGTMSA DPNDGGHLMI TSAAYEMSEL  600
GNFRVDNQVS LALGLRQREG DTITPFRGNT NAESTMGVGT SEFPYLEQVN QQHNRFGNPH  660
ILNDFVS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-16428486563Homeobox protein Meis2
3k2a_B2e-16428486563Homeobox protein Meis2
4xrs_A1e-16428485158Homeobox protein Meis1
4xrs_B1e-16428485158Homeobox protein Meis1
5bng_A2e-16428486159Homeobox protein Meis2
5bng_B2e-16428486159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010672737.10.0PREDICTED: BEL1-like homeodomain protein 3 isoform X1
RefseqXP_010672747.10.0PREDICTED: BEL1-like homeodomain protein 3 isoform X1
RefseqXP_010672754.10.0PREDICTED: BEL1-like homeodomain protein 3 isoform X1
SwissprotQ9FXG81e-117BLH10_ARATH; BEL1-like homeodomain protein 10
TrEMBLA0A0J8D8L20.0A0A0J8D8L2_BETVU; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.11e-118BEL1-like homeodomain 7